NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081474_122422

Scaffold Ga0081474_122422


Overview

Basic Information
Taxon OID3300005977 Open in IMG/M
Scaffold IDGa0081474_122422 Open in IMG/M
Source Dataset NameFerrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1316
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOne Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7330426Long. (o)-110.7089928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056742Metagenome / Metatranscriptome137Y
F077499Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0081474_1224222F056742N/AMTMKLADCRYKCKQTCFRKSIFVRMFKNEVEKTYGVKLKTCEDFCKFYVLFLSVAEMLYGKHYNYGIFKAIVRGKPNLYACVKCHQVFTAEESVTHTLQHMKQLGYNPLVYKEEI*
Ga0081474_1224223F077499N/AIGGHPDAGSPMDEKMRFLSTYMPLEFQKIQYMKAIDRALDILKYSLYSREDNVLFEIANKINGIYDVKELINKVKDVECTKDLKQVDVTLTEAKRYIYPDLSLSKYASAQAKQLNMRKYEYYARIFQCYINQDKDLDMLTLFRVSNTVYNYIRLNNLSNLVKKIQFKNDRIAQLMEKIKQRVKITLEAMSDRRPVEPDINVLNSITIRIKEIDLG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.