NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081474_142629

Scaffold Ga0081474_142629


Overview

Basic Information
Taxon OID3300005977 Open in IMG/M
Scaffold IDGa0081474_142629 Open in IMG/M
Source Dataset NameFerrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)5728
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (30.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOne Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7330426Long. (o)-110.7089928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021133Metagenome / Metatranscriptome220N
F023140Metagenome / Metatranscriptome211Y
F076262Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0081474_1426292F021133N/AMARRDELIRQIYENGNYAIKKICEMNPDDNMANFSATDCIIGTTNAHLALKIAKEKGYPPDVIEYLENQSRQEQWHCRLQIGKPPKPYDFIVAQKHREILLKYGIYVWMGVMQLLGEKIALAKAICWRRNDDPHFVNKFATIDEYYHTTYPLLLLYKYASEEELEKIVELQKEYIVNIFKLK*
Ga0081474_1426293F023140N/ALHERILISNIFIGLATVPIYIVLKSFPFFIVFGAGILTTLTVLILFFYFLGAKFVGTWAILQKFAVTLPTSFVLAHLVKLLPSDLFFDYIVLFFVGYTISTPLIFLTYYITMLLYGKKR*
Ga0081474_1426294F076262AGGTGGMSLNPVIKGSYTLAAPQTVSVAASSSSSVSISFTPLGAGELYVYIALPSEVTATISIGGQSVSLSNGGNQFIIPANTPIGNITINNSNTTAVTVVVWALFIEVA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.