Scaffold Ga0075160_10097659

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075160_10097659

Scaffold Ga0075160_10097659

Overview

Basic Information
Taxon OID	3300005988 Open in IMG/M
Scaffold ID	Ga0075160_10097659 Open in IMG/M
Source Dataset Name	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1619
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Geminisphaera → Geminisphaera colitermitum	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration

Source Dataset Sampling Location
Location Name	Milwaukee, Wisconsin, USA
Coordinates	Lat. (^o)	43.023	Long. (^o)	-87.895	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057452	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075160_100976595	F057452	N/A	WVNAPGPFINNWNNPSRPMTEIQDTVGSIAIVDGNTNTFEIWRIEQTDAWYNAGFGSAFLYDSREKSVASVGHVAKRHTGGFNASYCDGHAGFLKKSTLGAWTIRSGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.