Scaffold Ga0073910_1000238

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073910_1000238

Scaffold Ga0073910_1000238

Overview

Basic Information
Taxon OID	3300006005 Open in IMG/M
Scaffold ID	Ga0073910_1000238 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3582
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Columbia River, Washington
Coordinates	Lat. (^o)	46.372	Long. (^o)	-119.272	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071172	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073910_10002384	F071172	GAG	MTLTSQQLDQLIDNYAERIVDEMDLKCLMQFAYDTIVENMSHMNEEDVLNEIANVYDEDVIQELVESVTVE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.