NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066656_10226672

Scaffold Ga0066656_10226672


Overview

Basic Information
Taxon OID3300006034 Open in IMG/M
Scaffold IDGa0066656_10226672 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1196
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002588Metagenome / Metatranscriptome546Y
F012491Metagenome280Y

Sequences

Protein IDFamilyRBSSequence
Ga0066656_102266721F002588GAGMGARTPLPGQHPLAFRMRSFLKYLLERCKWASKRTGGVCGWVSLIVGASLAVLLWFSPRWFHDHISDRMTAFILVMVPLLAGAGVFLVRWVVSPYPIYMQIRRKLDTLTDAKKEERAKAVQGCFERSAAILKQHGSVLLSFHALSRAEGHRLESNEEVAEVCNLIQAVGYNHPFEGISPGYVPEKDWLSFLSYVKHAPKINPEEGKDYVDAADRWRQDHGYPVPSDDAGYVSLVERTLLR
Ga0066656_102266722F012491N/AKIQVRFKNDARSEIWDLNLVDDEGLSVTFDKVKLAGVDTVTLKDVNGKITAEIK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.