NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075024_100102798

Scaffold Ga0075024_100102798


Overview

Basic Information
Taxon OID3300006047 Open in IMG/M
Scaffold IDGa0075024_100102798 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1255
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania
CoordinatesLat. (o)41.5935Long. (o)-78.5142Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052842Metagenome / Metatranscriptome142N

Sequences

Protein IDFamilyRBSSequence
Ga0075024_1001027982F052842N/AQTTPTLETKPDIGRRETTASVATHQPGSGAVEIHDKITGTDVRKLLGGGELPAGLQSALKKMGPDALVKDAQTDSGIYRGAITGETDKKLIQQITSRIVVLHPKDLLDILPAVGENVRIAYSNDRASVVPVKDRSKTQEVGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.