Scaffold Ga0082018_1000737

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082018_1000737

Scaffold Ga0082018_1000737

Overview

Basic Information
Taxon OID	3300006091 Open in IMG/M
Scaffold ID	Ga0082018_1000737 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Major University, Chile
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	4608
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location
Location Name	Eastern Topical South Pacific
Coordinates	Lat. (^o)	-13.71	Long. (^o)	-81.389	Alt. (m)		Depth (m)	405
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057688	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082018_10007376	F057688	AGGAG	MKNNLLKAHYPSNTIFKQHFIIVGYEFGKKLEGELHKTVDIVCDCLHPDNTVDPRIEKLITKSELQELMDNQFMKRDGDQYIANPLLIYCVDDDYFLDEKRYAAQIKAAKLYYGIKR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.