NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0097679_1060263

Scaffold Ga0097679_1060263


Overview

Basic Information
Taxon OID3300006095 Open in IMG/M
Scaffold IDGa0097679_1060263 Open in IMG/M
Source Dataset NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_biof - 1398105538000 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1520
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location
Location NameSouth Africa: Cape Town
CoordinatesLat. (o)-33.927Long. (o)18.452665Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059673Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0097679_10602633F059673N/AMTKSMIIIELLLICYITLNSGKPHNLDEQTTTRTVTFIKPKANIMRRLNPLKLLFTVAHVPHADQPYSVEWNFPLLQTMLLESSYVSDEDKITFVSEFVNQLNKYAEWSDEKRNELERFTENYFNLYKSPDTFLPFIDCSALTYALTDEMINDLQPHASEQKRAEIRAKAVSRLCDSN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.