Scaffold Ga0007819_1066829

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0007819_1066829

Scaffold Ga0007819_1066829

Overview

Basic Information
Taxon OID	3300006105 Open in IMG/M
Scaffold ID	Ga0007819_1066829 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	747
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Crystal Bog, Wisconsin, USA
Coordinates	Lat. (^o)	46.0072	Long. (^o)	-89.6063	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037052	Metagenome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007819_10668292	F037052	N/A	MCKTMIDMGLEGASQKMIWSALGISKSTAENWRKKYPDFAEALDQALVHSQAYWERIMLANVDNKNFNTRMVEIAVRGQFAQDYRESKDTKIDIKNEVNTVDFNKSIQELLKKLRETE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.