Scaffold Ga0007858_1085251

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0007858_1085251

Scaffold Ga0007858_1085251

Overview

Basic Information
Taxon OID	3300006113 Open in IMG/M
Scaffold ID	Ga0007858_1085251 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	655
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Crystal Bog, Wisconsin, USA
Coordinates	Lat. (^o)	46.0072	Long. (^o)	-89.6063	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067436	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007858_10852511	F067436	N/A	TDINISAVQQIETQSFLSPIMLFPQLLFIGYIGFIFVSFYFSFYSSSSKEESTIDSDYLIASITVESEKEIGSMDDIIMTLIIVVYVFGWYFYTYC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.