Basic Information | |
---|---|
Taxon OID | 3300006138 Open in IMG/M |
Scaffold ID | Ga0080701_1000577 Open in IMG/M |
Source Dataset Name | Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_683M_control - microbial_metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Texas Southwestern Medical Center |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 36247 |
Total Scaffold Genes | 49 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 36 (73.47%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | UTSWMC, Dallas, Texas, USA | |||||||
Coordinates | Lat. (o) | 32.73 | Long. (o) | -96.97 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066905 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0080701_100057724 | F066905 | N/A | VNIHSILYENLKEVDIMPEEQRNCGCNQNNNNGCGCCGVLGNLFGGNGCCGDSEILFFIIIFLLLFTNFGCCGR* |
⦗Top⦘ |