Scaffold Ga0075422_10575292

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075422_10575292

Scaffold Ga0075422_10575292

Overview

Basic Information
Taxon OID	3300006196 Open in IMG/M
Scaffold ID	Ga0075422_10575292 Open in IMG/M
Source Dataset Name	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	519
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location Name	USA: Tennessee
Coordinates	Lat. (^o)	35.8444	Long. (^o)	-83.9599	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026955	Metagenome / Metatranscriptome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075422_105752922	F026955	N/A	VAVVGSDPVAEYVRLAAIPHENVEEVQEYLRRQESGSVILAVLERQNQPVALLKIHAGEATLFSFLPSQGGRVLMHETYIGKMYDATITQVHAVESLADASAPRPERVDIAGSRLGGVIDLTDYTAEERAALMDA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.