NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079037_100420930

Scaffold Ga0079037_100420930


Overview

Basic Information
Taxon OID3300006224 Open in IMG/M
Scaffold IDGa0079037_100420930 Open in IMG/M
Source Dataset NameFreshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1268
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie, Old Woman Creek
CoordinatesLat. (o)41.384Long. (o)-82.513Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053366Metagenome / Metatranscriptome141Y
F071377Metagenome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0079037_1004209301F053366AGGAGMRARAAAATLAVLSALVASLACGREGRQAPDQIRADIQALEKERQSLRERVGDLMANDARLKGMPDTPVRVGVPTTLARDLIQRVVAGFVDQVTLDLKNLKAKKSGKVKKVVTLGQYDLKVDIHRVSGRLKTGKPEVTFGGDQVALALPVTIASG
Ga0079037_1004209302F071377N/ALSAFACESKFKGGGDLRAQKVVLKREVDGLRDAVARLEKGQPILPIDDVAIAIDDTLLRDLIAAQLPFEMDVDRFHVSLTEAEAQFRGSPVVRLRGALNVKKRPSLAAAVNVIGALEGIAVDPASGTLRARIAVDHIGIEKAAGIEQLLSGATMDEVARTVRLRIKDLLPPIQIPVKVQQSIDLPAVTTGPVRIDGATMPLQVAVSQVLAGQGRLWIAVHFQPGDLVKTADAPEAGDASAAEAGFVLEGDDDAGPGKPAAKGKEK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.