Scaffold Ga0068500_1103894

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068500_1103894

Scaffold Ga0068500_1103894

Overview

Basic Information
Taxon OID	3300006332 Open in IMG/M
Scaffold ID	Ga0068500_1103894 Open in IMG/M
Source Dataset Name	Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hawaii
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14252
Total Scaffold Genes	31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	29 (93.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)	200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029781	Metagenome / Metatranscriptome	187	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068500_110389424	F029781	GGA	VSIVGFLSDVDVQGDVDDLLTSAATPSSNLMNRLISLGWRPDGEVPALLYGLSIFVMYYNEQRDEGVDIPIAIELAYGATINHPVISKLIASKTGAAIDGAAGV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.