 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006332 Open in IMG/M |
| Scaffold ID | Ga0068500_1147971 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 752 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047107 | Metagenome / Metatranscriptome | 150 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068500_11479711 | F047107 | N/A | RMYEHREENLVEAEALGRVGQDVGVNRVRGVRGPVGDRTFLGGQGLQDAAQPREHGQSAVLQFLDLQLFQVTRFGQGQRVESATRGDITDGEFVKDRVNHASSVRFGTANQDGFDDQNVPEGRVARAFRRQRGDGARELVRDGGAVIRGAQGTRGEPRDAGAVFGGPGASDAQHAPSAVDDFTLGVLFVAERDDRGFAPTRVGTEFRVDVSLDNLGDGLGL* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |