NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068493_10235362

Scaffold Ga0068493_10235362


Overview

Basic Information
Taxon OID3300006341 Open in IMG/M
Scaffold IDGa0068493_10235362 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4123
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)770
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010879Metagenome / Metatranscriptome298Y
F016206Metagenome / Metatranscriptome249Y
F023717Metagenome / Metatranscriptome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0068493_102353625F010879AGGAGMTKRKVLKEVLFDDVEEKIEYDFLTRDQFFQKVPETRPMSVRGIEMWERYLQDPKGFKF*
Ga0068493_102353626F016206AGGAMAKGKKKVSKAMGAILKAPKKAEKAVKAAVKHVNHTHWDTKDAFAAAIKKTGVNPNAINVNAEWDLYQSDTEGYRNHLKLEK*
Ga0068493_102353627F023717N/AVAKSRKMKSKKELENEGRTLGIELDRRHNREDLIEELEAFDIKVEPKELPRFATDAEAGFKEESSDVTWNSIEEFTEAVTSSGMLFNSDFIPVNIEALYEAFTSNPEEFKETPAYKFLTQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.