Scaffold Ga0099693_1018256

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099693_1018256

Scaffold Ga0099693_1018256

Overview

Basic Information
Taxon OID	3300006345 Open in IMG/M
Scaffold ID	Ga0099693_1018256 Open in IMG/M
Source Dataset Name	Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hawaii
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6526
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)	75
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043984	Metagenome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099693_101825616	F043984	GGAGG	MSMSISEMYQEMIDQYTEMYMYRKAHKGVRSGETNPEEILDDLSAIELDIEYTNES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.