Scaffold Ga0099953_1252597

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099953_1252597

Scaffold Ga0099953_1252597

Overview

Basic Information
Taxon OID	3300006351 Open in IMG/M
Scaffold ID	Ga0099953_1252597 Open in IMG/M
Source Dataset Name	Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hawaii
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	970
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)	45
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016534	Metagenome	246	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099953_12525971	F016534	N/A	VKDFGIDFPQFLGCFPRPNPHWIRNASIFQKKQDINIIVDFSLRFIQFPFLKSIFFKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.