Scaffold Ga0099654_10206888

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099654_10206888

Scaffold Ga0099654_10206888

Overview

Basic Information
Taxon OID	3300006415 Open in IMG/M
Scaffold ID	Ga0099654_10206888 Open in IMG/M
Source Dataset Name	Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Institut Pasteur, Lille, France
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	581
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom

Source Dataset Sampling Location
Location Name	Auvergne, France
Coordinates	Lat. (^o)	45.49	Long. (^o)	2.88	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000631	Metagenome / Metatranscriptome	971	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099654_102068882	F000631	N/A	MKWVAVAVALVAGFVCSDAVKLRASVRQEPDTACGKGFDNLVKGSQDYYRTAAVELFTHPSHTMDNATFEAEFECWFASMCTTKCGGLPSQADARKADLTAMCLSVEADWLKIWKMFSQEEIKWFKNNYPSDEVEGSEEGSEVHYKQAMETAKEVSKKELLCMTLFT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.