NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082249_10007017

Scaffold Ga0082249_10007017


Overview

Basic Information
Taxon OID3300006466 Open in IMG/M
Scaffold IDGa0082249_10007017 Open in IMG/M
Source Dataset NameDeep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VI
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCenter for Biotechnology (CeBiTec), Bielefeld Univeristy
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1543
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)77.978277Long. (o)0.163645Alt. (m)Depth (m)3500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092082Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0082249_100070172F092082N/AMGARMSGQATKKLHEATEAFMHDLEGARWTMMRVAQIQAKMSATMDECLGEFRDMFPTPEQQLDQANQYDNLSTQIQQDLPRIMQNKNGTHYDQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.