NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100226_1047608

Scaffold Ga0100226_1047608


Overview

Basic Information
Taxon OID3300006480 Open in IMG/M
Scaffold IDGa0100226_1047608 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1273
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003869Metagenome / Metatranscriptome464Y
F004869Metagenome / Metatranscriptome420Y
F007173Metagenome / Metatranscriptome356Y

Sequences

Protein IDFamilyRBSSequence
Ga0100226_10476082F003869GGAGGMAKRQNYKRPHFYSIGSMITDEEVHQVWEIVGNALDRNGFTDADGELSIRVYDETLKKNVVNVIDKSLEVN*
Ga0100226_10476085F004869GGAGMTYDTEHYYAVQSFLEDDELCKIWNIIEIAMNREGYDVENAELSMRLYDSELEENIEHDMENLLGSLSEGKDVDYGSKVDALVDTMGVTDEKESTVHRRKDLDSL*
Ga0100226_10476086F007173N/AISRNNLMEYIHEDRDLLMGLQDDLSDMLYATGKFSITLDEIVQNYMPFIPLYLIENEDEIKQAFPDRVTDDEYIFIYDRDMTPNEITLNVEWRD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.