 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006484 Open in IMG/M |
| Scaffold ID | Ga0070744_10018182 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2087 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Columbia River Estuary | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000450 | Metagenome / Metatranscriptome | 1126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070744_100181823 | F000450 | AGGCGG | MGDRANFGFVQPNGNTIVLYGHWAGHNMLAQLAEAVFKARPRWSDPSYATRITISQMINNDWNSETGWGLHVNEIGDNEHKVAIVDFNQQTFSLHEEAPRNDLDNKVNGMSNQAIFTMDLSNFVEKYADVTISV* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |