NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100964_120269

Scaffold Ga0100964_120269


Overview

Basic Information
Taxon OID3300006517 Open in IMG/M
Scaffold IDGa0100964_120269 Open in IMG/M
Source Dataset NameSludge microbial communities from wastewater anaerobic digester in Oakland, CA, USA ? phosphite and CO2 enriched
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Wastewater → Sludge Microbial Communities From Wastewater Anaerobic Digester In Oakland, Ca, Usa - Phosphite And Co2 Enriched

Source Dataset Sampling Location
Location NameOakland, CA, USA
CoordinatesLat. (o)37.825917Long. (o)-122.295833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070092Metagenome123N

Sequences

Protein IDFamilyRBSSequence
Ga0100964_1202691F070092AGGAGMAINDRLKPVMELLETSKQKIDLMISHGMASDLAIERRKKELYDEVMIAKENAFKEELAELEGEIRKIEDSYREPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHKFQNTGAIPGIPWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKSQHNKVSVLA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.