Scaffold Ga0079081_1123470

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079081_1123470

Scaffold Ga0079081_1123470

Overview

Basic Information
Taxon OID	3300006593 Open in IMG/M
Scaffold ID	Ga0079081_1123470 Open in IMG/M
Source Dataset Name	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_02_SludgeMetaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	663
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	USA: Illinois
Coordinates	Lat. (^o)	40.1191	Long. (^o)	-88.1952	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088944	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079081_11234701	F088944	N/A	ALQKNGLYLVMKVSPFIHYALDTDIIAPGYSGQYLIDPYNNFLLYTEEIEDSVVLDYLDLMTIFELQEALEKSIKEKQEGKGIDYSAIQDKWKLEFRFKEYQLTSYFRLRDQDANALDLTPMVDLLVKKEGLAMNKYAAARPTLTQAFDLMRQPETSNIFYALTHTLVKEPDGRILLYPDEDYIGKLGKIYICTECVFEGYIPKQLWLGLRGFKDLKSIQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.