Scaffold Ga0101566_11020865

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101566_11020865

Scaffold Ga0101566_11020865

Overview

Basic Information
Taxon OID	3300006618 Open in IMG/M
Scaffold ID	Ga0101566_11020865 Open in IMG/M
Source Dataset Name	Soil microbial communities from the Leymus chinensis steppe, China - without N addition
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chengdu Institute of Biology, Chinese Academy of Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	727
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition

Source Dataset Sampling Location
Location Name	the Inner Mongolia Grassland Ecosystem Research Station (IMGERS), China
Coordinates	Lat. (^o)	43.63	Long. (^o)	116.7	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010841	Metagenome / Metatranscriptome	298	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101566_110208651	F010841	N/A	MKTLTNIGTTRRVILLVICLLSFGCQRQIAEKEGPPFRIVATDAGFEAPDSLVAGLRHIIFENHGSEIHEGMLVKLPEGMSADDYVAAVKKGFLFPEGALDYSGPGLTSPGATAEMWLRVDPGNYIIICWNKDHDKTTPVHSFTVEDIGAADDRPPKEDVVLKLFDYRFELNRALSKGAQVIRVETPGPNMHEVDIYRLHEGSSVTDLNRWRKAHEHGSSPADALGGALDNHDI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.