NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075522_10000824

Scaffold Ga0075522_10000824


Overview

Basic Information
Taxon OID3300006638 Open in IMG/M
Scaffold IDGa0075522_10000824 Open in IMG/M
Source Dataset NameArctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22955
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (65.62%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameUSA: Barrow Environmental Observatory site, Alaska
CoordinatesLat. (o)71.299Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063097Metagenome / Metatranscriptome130Y
F070252Metagenome / Metatranscriptome123Y
F077836Metagenome / Metatranscriptome117Y
F084395Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0075522_1000082412F077836GGCGGMVGPADIVFVTLIAIGAVVLVGVLGYLIDKKGTQEGDQEGSKDK*
Ga0075522_1000082424F063097GGAGLSVQPGKAAAGKPKVVDPANVAANLRDLTVHLHRGNAAEAKTIAAQAAEQLQEIIQADDPESVLIARAQQTMFAIEEVRIMLSQDDVNGALAAARDATKEWRIK*
Ga0075522_1000082425F084395N/AMLLWRDDFSTLTLEEVLRYQLENRAWSKDLRFRSNQLVNKRLANEITQDDYLTNRKITRQEAEECQRRAAILDSQISRSGVRPLLHAS*
Ga0075522_1000082430F070252N/AMKFLGSLLLMVLSFALSARCVAAQDDQDKDSYFTGTLVENAPDHLKVSRVLQGKTEAHVFKITAETKVEGGRLRLRQRINVRYITSDDGDVAILVIVRPSKAQLKKQK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.