NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101770_1019480

Scaffold Ga0101770_1019480


Overview

Basic Information
Taxon OID3300006674 Open in IMG/M
Scaffold IDGa0101770_1019480 Open in IMG/M
Source Dataset NameAnaerobic microbial community collected from a biogas reactor in Fredrikstad, Norway. Combined Assembly of Gp0117115, Gp0124038
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35930
Total Scaffold Genes60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)56 (93.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Food Waste → Mirobial Communities In Biogas Reactors

Source Dataset Sampling Location
Location NameFredrikstad, Norway
CoordinatesLat. (o)59.185359Long. (o)10.970104Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022008Metagenome / Metatranscriptome216Y
F033769Metagenome / Metatranscriptome176N
F066897Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0101770_101948043F066897AGGAMNSKWFWLIIIAVVLLSAVFIWHNHTSTQDMLLKAQETIKETQEALKESQEALIKLDKIAQEIKDTSQIAKKAGDEYVKEVLLISDDEFLDKLNAYSTVMVERVKQLE*
Ga0101770_101948044F022008AGGAMTMNDVEMLREALSDLSKQLQTLSDESRTSFGRIYDRLTKIETQMSEREHQFNRYEKMLDNHETRIRAVEGELGTLRDVPERLWRVSMSNSKLTGMIAAAGGVGGLVATIIVKMLGE*
Ga0101770_101948049F033769GGAGGMSTVNCGVXTATYTPSTVGVAGGRKYLRLTNESLDMRCRAGASNISSNAGIIIEPGQTVEFRPLPSENREIYVMSEGKAVKLAYYEVIV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.