Basic Information | |
---|---|
Taxon OID | 3300006717 Open in IMG/M |
Scaffold ID | Ga0031665_1027417 Open in IMG/M |
Source Dataset Name | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0548 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 574 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 9201 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -26.95 | Long. (o) | -21.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036277 | Metagenome / Metatranscriptome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0031665_10274172 | F036277 | AGGA | LCSNPFVDKTTQYELLSPNKNKIDLSYLGSASLDN* |
⦗Top⦘ |