NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098068_1036590

Scaffold Ga0098068_1036590


Overview

Basic Information
Taxon OID3300006733 Open in IMG/M
Scaffold IDGa0098068_1036590 Open in IMG/M
Source Dataset NameMarine viral communities from Cariaco Basin, Caribbean Sea - 26B_WHOI_OMZ_CsCl
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)966
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameCaribbean Sea: Cariaco Basin
CoordinatesLat. (o)10.847Long. (o)-65.114Alt. (m)Depth (m)900
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044014Metagenome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0098068_10365901F044014AGGAGMTDEDYRPRFSFEITEEQKQRADKLLDTYGLRKAIFGKVLDDILDLIEDYGGIAIGIMMSGKSKPRDVIPLMKRAEEVGER*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.