Scaffold Ga0098039_1076888

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0098039_1076888

Scaffold Ga0098039_1076888

Overview

Basic Information
Taxon OID	3300006753 Open in IMG/M
Scaffold ID	Ga0098039_1076888 Open in IMG/M
Source Dataset Name	Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1156
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	-11.499	Long. (^o)	-81.405	Alt. (m)		Depth (m)	210
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003952	Metagenome	460	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098039_10768885	F003952	GGAG	MVYNLLLYMGIFFLVGGFSLFLYSEMKLREIDIQLFKLEQKIKEELNK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.