Scaffold Ga0098074_1067082

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0098074_1067082

Scaffold Ga0098074_1067082

Overview

Basic Information
Taxon OID	3300006790 Open in IMG/M
Scaffold ID	Ga0098074_1067082 Open in IMG/M
Source Dataset Name	Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	982
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Atlantic Ocean: Gulf of Mexico
Coordinates	Lat. (^o)	28.867	Long. (^o)	-90.467	Alt. (m)		Depth (m)	18
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070661	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098074_10670822	F070661	GGA	MSKLIRKFENNLDWLTAAAAGEADLRENHKLYTKVHRFYSKEGIVFTGDSETDYTIIVNYLSEDLA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.