NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070749_10011120

Scaffold Ga0070749_10011120


Overview

Basic Information
Taxon OID3300006802 Open in IMG/M
Scaffold IDGa0070749_10011120 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5815
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.12Long. (o)-75.25Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003637Metagenome / Metatranscriptome476Y
F020921Metagenome / Metatranscriptome221Y
F072428Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0070749_1001112011F020921GAGMATPAVPTTNVGIYNHLREATDCNQTTNLSLASLCNGGTYNGIQNTFGGQGGRAMFFDVIGGTNNPITTTPNTLNLFDDIIGTAPFNLANTIGGKYI*
Ga0070749_1001112012F003637AGGAMAKVIAEKVQESNPAEVIKQVEIKHTRSMQDASGKDVVVVDHIEVKSVDDAISQSEKDKARLEAQLAEVTAELADYIAIRDAE*
Ga0070749_100111206F072428AGGMDLAESIKKLKEISVILQAKTVSDREKEFYMPELFKVIDSLDVPQLIGEFDNEYVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.