Scaffold Ga0075431_100078267

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0075431_100078267

Scaffold Ga0075431_100078267

Overview

Basic Information
Taxon OID	3300006847 Open in IMG/M
Scaffold ID	Ga0075431_100078267 Open in IMG/M
Source Dataset Name	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3413
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location Name	USA: Tennessee
Coordinates	Lat. (^o)	35.8443	Long. (^o)	-83.9607	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054337	Metagenome / Metatranscriptome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0075431_1000782672	F054337	N/A	MSQKIKLSLIMYSVIGSVIFLNLGLFQEGLAQNLINSNLPTPNDTEIQDVNNQSTDRDNGLANVPLVINITKNSNATETVIDFIINQVNSSVVDISVLEDLAKDRIPLLIDTLKNTNASSIAAEYVLNTTKNEILTNTTSS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.