Basic Information | |
---|---|
Taxon OID | 3300006852 Open in IMG/M |
Scaffold ID | Ga0075433_10116698 Open in IMG/M |
Source Dataset Name | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2368 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Tennessee | |||||||
Coordinates | Lat. (o) | 35.8444 | Long. (o) | -83.9599 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011381 | Metagenome / Metatranscriptome | 291 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075433_101166982 | F011381 | AGGA | MRRLVFSTLIILFVAVNLHAQAAADSTEQKQAEDFLKRLNALTDWHLTVDGKEDGLEPLVNNMMELFAPDALAEVPPHDKEQIGPVMLRGKDNVKKWLEAIARTQSRLEYYFKRQTEGPTGDFEGWRLVYSAKLPWGGTGIAFPIMGVWSQRDTRHRYMAPGVTFIQYGTDGKIKRLRLLLGEIEEVVPL* |
⦗Top⦘ |