Scaffold Ga0079041_1019865

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079041_1019865

Scaffold Ga0079041_1019865

Overview

Basic Information
Taxon OID	3300006857 Open in IMG/M
Scaffold ID	Ga0079041_1019865 Open in IMG/M
Source Dataset Name	Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - ECH_B host_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	832
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Sulfolobales → Sulfolobaceae → Sulfolobus → Sulfolobus acidocaldarius	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park
Coordinates	Lat. (^o)	44.7219	Long. (^o)	-110.7021	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067919	Metagenome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079041_10198651	F067919	N/A	LEIRYWGFSLSTRSLSRGKELILINKGDEIEFLIDNVDDGRVWIIKPEYHTKKGIMVLEKRNGYIIRLIEKDLRKLGVRNMNELIELIRTRPSETVENLIGEKVKISKVTVKDLSNSNAED*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.