Scaffold Ga0079215_11581849

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079215_11581849

Scaffold Ga0079215_11581849

Overview

Basic Information
Taxon OID	3300006894 Open in IMG/M
Scaffold ID	Ga0079215_11581849 Open in IMG/M
Source Dataset Name	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	520
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Dacryobolaceae → Postia → Postia placenta	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location Name	USA: Utah
Coordinates	Lat. (^o)	41.7655	Long. (^o)	-111.8143	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088384	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079215_115818491	F088384	AGCAG	VTITDWEASAVQEERREQLVEEIRTAERARNLLVGLERRLKERNRSDMEEHLGHLERLAGSLPEGHTVRLLAEDAVRSARTRGAGYAYSAASRCRSKTEGRLSTLRGSLSRLDAFAGRDA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.