Scaffold Ga0079216_10563132

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079216_10563132

Scaffold Ga0079216_10563132

Overview

Basic Information
Taxon OID	3300006918 Open in IMG/M
Scaffold ID	Ga0079216_10563132 Open in IMG/M
Source Dataset Name	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	773
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location
Location Name	USA: North Logan, Utah
Coordinates	Lat. (^o)	41.7655	Long. (^o)	-111.8143	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035463	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079216_105631321	F035463	N/A	QLAESLERSAKSAGQTIVKESLTVEIGIGLQVLTAALKRNKLPTEKEITTGVDLMYAYVSIDGQRALPAGYYRIRLAIPGYEKSGDVKVSFIDAEGKSVHSLTGKGRPRSLKPGTADDNIAGPPVPMFCGNKKCFNIKRNGFLDWDWGCTDLNGNTINCLDRQP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.