Scaffold Ga0079303_10016667

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079303_10016667

Scaffold Ga0079303_10016667

Overview

Basic Information
Taxon OID	3300006930 Open in IMG/M
Scaffold ID	Ga0079303_10016667 Open in IMG/M
Source Dataset Name	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2301
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Ohio
Coordinates	Lat. (^o)	41.3769	Long. (^o)	-82.5172	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021563	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079303_100166672	F021563	N/A	MDDLKLLLIDRLKSKDIDPTLIPAFLKALTSIISSEPGIELAQVNQKLNLLGWNEVSIDYHSLQIAIACLVTEMN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.