 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006934 Open in IMG/M |
| Scaffold ID | Ga0080680_1257893 Open in IMG/M |
| Source Dataset Name | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 549 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Mus → Mus → Mus musculus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil → Tropical Rainforest Soil Microbial Communities From The Amazon Forest, Brazil, For Analyzing Deforestation At Different Spatial Scales |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon Forest, Brazil | |||||||
| Coordinates | Lat. (o) | -10.0 | Long. (o) | -62.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065469 | Metagenome / Metatranscriptome | 127 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0080680_12578931 | F065469 | N/A | AGMQRHRALQPESPGAYPFRSPPPFLWATAQCFQVHLLALPAGTGISQRPFTHPKRLPVSGPPFRGQSSRPAASTPCRPIVAPVRIPTSLRDPVRPGARRLNVGIPLPDFRPALPAFPRISTPLWGLSDPSGSKRSIRFRAGKSASRALPIALHSLASKLFY* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |