 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006944 Open in IMG/M |
| Scaffold ID | Ga0099823_1067063 Open in IMG/M |
| Source Dataset Name | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1690 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | California, USA | |||||||
| Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018329 | Metagenome | 235 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099823_10670634 | F018329 | N/A | LLSCGDTSEVGSYVPCSHLRDAACGEVHSWWITCVGLPAGSFVELDHERAGSWKHWNP* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |