 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300006958 Open in IMG/M |
| Scaffold ID | Ga0101660_102820 Open in IMG/M |
| Source Dataset Name | Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31is |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 684 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Upa-Upasina | |||||||
| Coordinates | Lat. (o) | -9.8241 | Long. (o) | 150.825833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053330 | Metagenome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101660_1028202 | F053330 | AGG | MAGTSIYSVYRRTARAAAKQQVVKKTSSVDVDKARSDFAY |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |