Basic Information | |
---|---|
Taxon OID | 3300007004 Open in IMG/M |
Scaffold ID | Ga0079218_13379688 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 541 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah | |||||||
Coordinates | Lat. (o) | 41.7655 | Long. (o) | -111.8143 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048342 | Metagenome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079218_133796882 | F048342 | N/A | YTRLELVDKNQLLRDDDRLSLGITEHHPSFRIGAYSFGGARDIWNTESTSLAIGSDVTFYSKPPILDSLYGANPVSWKLFVRVRPAPMSMSRMHGH* |
⦗Top⦘ |