Basic Information | |
---|---|
Taxon OID | 3300007032 Open in IMG/M |
Scaffold ID | Ga0102620_118541 Open in IMG/M |
Source Dataset Name | T18 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 662 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | UK (Newcastle upon Tyne) | |||||||
Coordinates | Lat. (o) | 54.971158 | Long. (o) | -1.703654 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050029 | Metagenome / Metatranscriptome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102620_1185412 | F050029 | GAGG | MATIVIHWKDKEIPPMELKAAAYKGADSSIINITSNGKDYWFNWSECWYLETTSTE* |
⦗Top⦘ |