Scaffold Ga0102672_116574

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102672_116574

Scaffold Ga0102672_116574

Overview

Basic Information
Taxon OID	3300007038 Open in IMG/M
Scaffold ID	Ga0102672_116574 Open in IMG/M
Source Dataset Name	Non-marine hypersaline water viral communities from A?ana, Logro?o, Spain -Vir_A?ana_balsa_PRE
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	712
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain

Source Dataset Sampling Location
Location Name	Añana
Coordinates	Lat. (^o)	42.80111387	Long. (^o)	-2.985507	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102672_1165742	F066493	N/A	MTETRTREFDSGVVDVADELVQQHGPRGAIERLQQRRQTASDELAARCNEALAWIRREVIDEEGTDG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.