NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101554_1017072

Scaffold Ga0101554_1017072


Overview

Basic Information
Taxon OID3300007049 Open in IMG/M
Scaffold IDGa0101554_1017072 Open in IMG/M
Source Dataset NameMarine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st32ic
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)650
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013419Metagenome271Y

Sequences

Protein IDFamilyRBSSequence
Ga0101554_10170722F013419GAGGMIRESKYSFLYRAHDGSIMKPENFLNINKGRTLSSSQLRMLGITKIKNPSYKRQASSRKLDKQPE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.