Scaffold Ga0101549_1035707

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101549_1035707

Scaffold Ga0101549_1035707

Overview

Basic Information
Taxon OID	3300007117 Open in IMG/M
Scaffold ID	Ga0101549_1035707 Open in IMG/M
Source Dataset Name	Marine sponge Stylissa sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - st20is
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	927
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Upa-Upasina, Papua New Guinea
Coordinates	Lat. (^o)	-9.40556	Long. (^o)	150.816667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023046	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101549_10357074	F023046	N/A	INGVRNKRSHLVGPPFPEFKAHFSATAGWHFSRDLTRHLLIGGCGHSTYLLSMAEITSGSSFEPNNLTELKLGYV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.