Basic Information | |
---|---|
Taxon OID | 3300007137 Open in IMG/M |
Scaffold ID | Ga0101673_1015608 Open in IMG/M |
Source Dataset Name | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'control', water-dc |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1155 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Dobu 'control' site, Papua New Guinea | |||||||
Coordinates | Lat. (o) | -9.752083 | Long. (o) | 150.854133 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021115 | Metagenome / Metatranscriptome | 220 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101673_10156083 | F021115 | AGGAG | MRNHETTAELDNPLSLSKIGAYSGSIKATFFKDNKRYTGVPSVEINDELRAIICNSKIKIQPYTVKNNNSHFEIVLPKNIKGGLANLIIVKTLTTVGLKHKCISCKLEVDGNEKTICFHY |
⦗Top⦘ |