NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103274_1195044

Scaffold Ga0103274_1195044


Overview

Basic Information
Taxon OID3300007202 Open in IMG/M
Scaffold IDGa0103274_1195044 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational University of Singapore, Singapore-MIT Alliance for Research and Technology, The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1518
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freashwater Reservoir, Singapore (Monthly Sampling)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.286816Long. (o)103.867024Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033771Metagenome176N
F045056Metagenome153N

Sequences

Protein IDFamilyRBSSequence
Ga0103274_11950442F045056N/AMKFTAEIESQVLGIGSDVTKEVKLSESKDVNLAMVRWMSDVIKLTVEGIEKVDAKATLNLRQSVDFSELPVEAKVAQVAMEMASYWKFVEYGVNGVQTNRGAPFSFRYITPSPRHVAAIRKWIVDKALGIPADEIDEAAYNMARATKRRGIKPRPFLNPVLTDDKLNELVVSIAEVAGKEISLSMSK*
Ga0103274_11950443F033771N/ALSRTGSVDAERGNVGQNTTTTIMSLLHEITVDQLQRISSIENNTIYTASDKKVGVVAVVDGVPIAEVMHRTIAQVNKRYAEIQQASQQLPSLQAKRTIRVGAKWYRFEWFIDEITAGQLVELFSYDMTSELAVIDNLHLILATLSRECRVWKWWPKAYDGKGHKERAEAMRQMVVADVWGYAAFFLQLSEPLLTIMRKSLMDQATTTTTAKG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.