Scaffold Ga0103274_1218979

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103274_1218979

Scaffold Ga0103274_1218979

Overview

Basic Information
Taxon OID	3300007202 Open in IMG/M
Scaffold ID	Ga0103274_1218979 Open in IMG/M
Source Dataset Name	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	National University of Singapore, Singapore-MIT Alliance for Research and Technology, The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2049
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium TBK1r	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freashwater Reservoir, Singapore (Monthly Sampling)

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.286816	Long. (^o)	103.867024	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091636	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103274_12189792	F091636	AGGAG	MIHAQFDKVLATLPTAAIGSTATSTLTIDRLGYDHVSVAAIRASNASTVFASVLKVEESDDNSSYSNVTALVGGGTGGFSIPAVSDTNNAAIVKMDIDCRAKKRYLKVSMTPGASATLALTARLSQAEEAPVSASDAGVIGLVKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.