NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103959_1100850

Scaffold Ga0103959_1100850


Overview

Basic Information
Taxon OID3300007214 Open in IMG/M
Scaffold IDGa0103959_1100850 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE), The Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1557
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.409238Long. (o)103.907928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020324Metagenome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0103959_11008502F020324GAGMPIVTLRYTLPDEQGEYDAARLGSEAMQVLWQIDQRLRSLLKHGEPTTEQAELAEEIRAMIPAELLEI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.